Training Example: AccrediPro University – Review the Data, Give Your Score & Compare to the Real AI Evaluation

Established MMXVIII·Accredited in 47 Countries·★ ★ ★ ★ ★4.9/5 on Trustpilot · 1,157+ reviews·Fall Session: Applications Open✦AccrediPro University · Est. MMXVIII✦
[H1] The university for a new generation of practitioners.
Twenty-five colleges. Forty-six bachelor specializations. One academic standard — built for clinicians, coaches, and entrepreneurs who want to practice, not just learn.Browse Catalogue Request Curriculum (PDF)Free curriculum · No credit card · Reply within 24 hours50,000+Active Students47Accredited Countries4.9/5Trustpilot · 1,157+ ReviewsRecognized · Accredited · Endorsed
[H3] Backed by nine international accreditation bodies.
Our programs are reviewed, approved, and continuously audited by independent professional councils across Europe, the United Kingdom, and North America.
[IMG: Accreditation bodies: CMA, CPD, CTAA, IPHM, IGCT, IAOTH, IHTCP, IIOHT, ICAHP]
CMAComplementary Medical AssociationIPHMInternational Practitioners of Holistic MedicineCPDCPD Certification Service · Provider #788875IAOTHInternational Association of TherapistsICAHPInternational Council for Accreditation of Health PractitionersIGCTInternational Guild of Complementary TherapistsCTAAComplementary Therapists Accredited AssociationIHTCPInternational Holistic Therapies CouncilIIOHTInternational Institute of Holistic TherapiesVeritas in CuraTruth in Care · University MottoThe Twenty-Five Colleges
[H2] Twenty-five colleges, one shared discipline.
Each college confers its own diplomas, ladder-structured across six progressive levels — from Foundation Certificate to Fellow Practitioner.FIMSchola I
[H3] Functional & Integrative Medicine
Root-cause diagnostics, systems biology, evidence-based clinical protocols for complex chronic disease.300 programs · 6 levels→NMHASchola II
[H3] Natural Medicine & Healing Arts
Herbalism, traditional systems, energy medicine — taught with academic rigor and clinical accountability.245 programs · 6 levels→BHPSSchola III
[H3] Behavioral Health & Psychological Sciences
Trauma, somatics, autonomic regulation. For therapists, counsellors and relational clinicians.225 programs · 6 levels→NCPAHSchola IV
[H3] Nursing, Clinical Practice & Allied Health
Bridge programs for RNs, paramedics and allied clinicians moving into integrative practice.220 programs · 6 levels→CDFLSSchola V
[H3] Child Development, Family & Lifespan Sciences
Pediatric integrative health, family systems, lifespan developmental science from birth to elder care.215 programs · 6 levels→PSALSchola VI
[H3] Professional Studies & Applied Leadership
Practice management, clinical ethics, organizational leadership for directors of integrative care.165 programs · 6 levels→NSMHSchola VII
[H3] Nutritional Sciences & Metabolic Health
Nutrigenomics, microbiota, metabolic protocols. Clinical nutrition with a research backbone.160 programs · 6 levels→MSRTSchola VIII
[H3] Movement Sciences & Rehabilitative Therapies
Biomechanics, manual therapies, structural rehabilitation grounded in functional medicine.145 programs · 6 levels→WHRSSchola IX
[H3] Women’s Health & Reproductive Sciences
Cycles, fertility, perimenopause, postpartum. The full reproductive lifespan, integratively.145 programs · 6 levels→AMDSSchola X
[H3] Aesthetic Medicine & Dermatological Sciences
Evidence-based aesthetics, cosmetic dermatology, and regenerative skin science for clinical practitioners.125 programs · 6 levels→SMPSSchola XI
[H3] Sports Medicine & Performance Sciences
Athletic performance, injury prevention, and integrative sports rehabilitation for elite and recreational populations.90 programs · 6 levels→ECTASchola XII
[H3] Expressive & Creative Arts Therapies
Art, music, dance, and drama therapy modalities applied within clinical and community wellness settings.90 programs · 6 levels→DHTISchola XIII
[H3] Digital Health & Technology Innovation
Health informatics, telehealth systems, AI-assisted diagnostics, and digital therapeutics for modern practice.85 programs · 6 levels→VWASSchola XIV
[H3] Veterinary Wellness & Animal Sciences
Integrative veterinary medicine and animal nutrition. Taught by practicing DVMs.85 programs · 6 levels→GCWHSchola XV
[H3] Global & Cross-Cultural Wellness & Health
Comparative health systems, cultural competence in care, and international public health perspectives.80 programs · 6 levels→MHASSchola XVI
[H3] Men’s Health & Andrological Sciences
Hormonal health, urological wellness, and integrative approaches to male lifespan medicine.80 programs · 6 levels→LSRASchola XVII
[H3] Longevity Science & Regenerative Aging
Senescence biology, regenerative medicine, and evidence-based protocols for healthspan extension.75 programs · 6 levels→PSARSchola XVIII
[H3] Pain Science, Addiction & Recovery Care
Chronic pain management, addiction neuroscience, and recovery-oriented models of integrative care.75 programs · 6 levels→SXRHSchola XIX
[H3] Sexual & Reproductive Health
Sexual wellness, reproductive medicine, and clinical sexology through an integrative health lens.70 programs · 6 levels→SFPWSchola XX
[H3] Spiritual, Faith & Pastoral Wellness
Pastoral care, spiritual direction, contemplative practices, and faith-informed approaches to healing.70 programs · 6 levels→EHESSchola XXI
[H3] Environmental Health & Ecological Sciences
Toxicology, environmental medicine, and the intersection of ecological systems and human health.65 programs · 6 levels→OEWHSchola XXII
[H3] Occupational, Ergonomic & Workplace Health
Workplace wellness design, ergonomic science, and occupational health strategy for modern organizations.65 programs · 6 levels→SNPSSchola XXIII
[H3] Sleep & Neurophysiological Sciences
Sleep medicine, circadian biology, and neurophysiological assessment for restorative health practice.65 programs · 6 levels→FNBSSchola XXIV
[H3] Forensic, Neuropsychological & Social-Behavioral Sciences
Forensic psychology, neuropsychological assessment, and social-behavioral determinants of health.60 programs · 6 levels→FWFPSchola XXV
[H3] Financial Wellness & Fiscal Psychology
Behavioral finance, financial therapy, and the psychology of economic decision-making in health contexts.55 programs · 6 levels→Academic Ladder · Class of MMXXVI
[H2] Six levels, one ascending discipline.
Every college offers its programs across six progressive levels — from Foundation Certificate to Fellow Practitioner. Choose the rung that matches where you are.IFoundationIIMiniIIIProfessionalIVAdvancedVMasterVIFellowIÆFoundationCertificate · 40–80 hours · 8–12 weeks
[H3] Accelerated Foundation Certificate
The first step on the ladder. A focused entry into the discipline for newcomers and curious practitioners — one program per college.Rolling admissions25 collegesOnline + cohortAvailable acrossFIMNMHABHPSNCPAHCDFLSPSALNSMHMSRTWHRSAMDSSMPSECTADHTIVWASGCWHMHASLSRAPSARSXRHSFPWEHESOEWHSNPSFNBSFWFPFull Catalogue · Year MMXXVI Faculty of Bachelor Degrees
[H2] Our Bachelor's degrees.
Beyond the Twenty-Five Health Colleges, AccrediPro University confers Bachelor of Science and Bachelor of Arts degrees across seven academic colleges — reviewed by licensed clinical faculty, combining Swiss academic rigor with real-world expertise.ÆASW7 programs · BSc/BA
[H3] College of Aesthetic Sciences & Wellness
Bridging scientific rigor and beauty expertise. Aesthetics, trichology, holistic nutrition, and oncological care.Aesthetic Science & Cosmetic TechnologyTrichology & Hair Health ScienceFunctional Nutrition for WellnessOncological Aesthetic Care+ 3 moreView specializations→ΛLPS9 programs · BSc/BA
[H3] College of Law & Political Sciences
Jurisprudence, public administration, corporate communication, and the new academic study of the creator economy.Legal Services for BusinessCriminology & Criminal JusticePublic Administration & GovernmentDigital Communication & Media+ 5 moreView specializations→ΞENT11 programs · BSc/BA
[H3] College of Engineering & Technology
Industrial, civil, energy, software, and frontier programs in autonomous systems and electric mobility.Software Engineering & App DevelopmentHybrid & Electric Vehicle EngineeringDrone Technology & Autonomous SystemsIndustrial Engineering — Energy+ 7 moreView specializations→ΒBUE7 programs · BSc/BA
[H3] College of Business & Economics
Strategy, finance, entrepreneurship, hospitality and tourism for a dynamic international marketplace.Business AdministrationBanking, Finance & InsuranceStartup Entrepreneurship & InnovationHospitality & Destination Management+ 3 moreView specializations→ΨHSP5 programs · BSc/BA
[H3] College of Human Sciences & Psychology
Psychology, sociology, social work, and the science of mental performance and personal coaching.Psychological SciencesMental Biohacking & Performance CoachingSociologySocial Work & Community Services+ 1 moreView specializations→ΣSPS2 programs · BSc/BA
[H3] College of Sports Sciences
Athletic performance, sports science, and the business of professional sport — with a football management specialization.Sports Science & Physical ActivitySports & Football ManagementView specializations→ΑACE5 programs · BSc/BA
[H3] College of Arts, Culture & Education
Heritage conservation, performing arts, fashion design, gastronomy, and the science of education.Cultural Heritage ConservationFashion Design & Creative IndustriesGastronomic & Food SciencesEducation & Training Sciences+ 1 moreView specializations→46Degree SpecializationsEach Bachelor's program is reviewed by our standing Clinical Faculty Board — combining scientific rigor with real-world health expertise.Full Bachelor Catalogue Vocatio · Career Outcomes
[H2] Where our graduates go.
Five career trajectories pursued by AccrediPro University alumni — informed by our 2024 graduate survey of 3,200+ respondents across all Twenty-Five Health Colleges and Faculty of Bachelor Degrees.94%Employed or self-employed within 6 months of graduation68%Report income increase within first year of practice3,200+Alumni surveyed · Class of 2018 — 20240138%Clinical · Private Practice
[H3] Functional Medicine Practitioner
Open a private functional medicine clinic, integrate with existing medical practice, or join a multidisciplinary wellness center.€ 75 — 180 KEU avg. annualshare of graduates0224%Coaching · Corporate Wellness
[H3] Health Coach & Wellness Consultant
Build a private coaching practice, contract with corporate wellness programs, or specialize in oncological, athletic, or longevity coaching.€ 45 — 110 KEU avg. annualshare of graduates0314%Academia · Research
[H3] Clinical Researcher & Faculty
Publish original research, lecture at AccrediPro University and partner institutions, or contribute to international clinical trials.€ 60 — 140 KEU avg. annualshare of graduates0416%Entrepreneur · Industry
[H3] Founder · Healthtech & Clinics
Launch a clinical brand, healthtech platform, or franchise of integrative care centers — supported by our Foundation network.€ 90 — 250 K+Year 3 founder avg.share of graduates058%Public · Institutional
[H3] Specialist · Hospital & Public Health
Integrate functional protocols inside hospital systems, ministerial bodies, and public health initiatives across our 47 accredited countries.€ 55 — 120 KEU avg. annualshare of graduatesVeritas in Cura. Source: AccrediPro University Office of Institutional Research, 2024 Graduate Outcomes Survey · n=3,247 · response rate 71%.The Academic Method
[H2] Three principles that set us apart.
Principle I
[H3] Only practicing faculty.
Every chair is held by a clinician seeing patients every day. No pure academics, no theory that doesn't pass through the hand of the one teaching it.“You teach what you practice. Everything else is opinion.”P·ILectio Practica · Clinical HallP·IICasus Reales · Clinical MaterialsPrinciple II
[H3] Real cases, not simulated.
Every student works on 40+ real clinical cases — documented, anonymized and discussed with the chair. That is how clinicians are formed, not with quizzes.“The clinical case is the only lesson that leaves a trace.”Principle III
[H3] Selective admission.
We receive 4,000 applications per year. We admit 600. Not for exclusivity — to ensure every student receives the time, space, and rigor of a true university.“A small class is a class that knows itself.”P·IIISelectio · Cohorts of 40Clinical Faculty Board
[H2] Eight reviewers, licensed and practicing.
Every program we confer is reviewed by our standing Clinical Faculty Board — eight licensed clinicians whose credentials sit alongside the diploma you earn.
[IMG: Dr. Maria Krista A. Pinol]
[H3] Dr. Maria Krista A. Pinol
Medical Director · Lead Clinical ReviewerMD · RN
[IMG: Edsa Raisa O. Cordova]
[H3] Edsa Raisa O. Cordova
Lead Functional Nutrition ReviewerRND
[IMG: Nico Salvador Lapidez]
[H3] Nico Salvador Lapidez
Metabolic & Autoimmune ReviewerRND
[IMG: Dr. Alvy Toledo]
[H3] Dr. Alvy Toledo
Psychiatric & Neurodevelopmental ReviewerMD · RPm
[IMG: Hazel Veronica Malazarte]
[H3] Hazel Veronica Malazarte
Behavioral Intervention & Coaching ReviewerRPsy · LPT
[IMG: Jessa Mae Sumaya]
[H3] Jessa Mae Sumaya
Maternal & Reproductive Health ReviewerRM
[IMG: Angelu Marie Diloy]
[H3] Angelu Marie Diloy
Pediatric & Neonatal Clinical ReviewerRN
[IMG: Carol Joy Valencia]
[H3] Carol Joy Valencia
Public Health & Geriatric Nutrition ReviewerRNDMeet the Full Board Voices from the Archive · Alumni
[H2] Twelve hundred reviews, in their own words.
A 4.9/5 rating across 1,157+ verified reviews on Trustpilot. Below, a live grid of recent alumni voices — no curation, no editing.“The clinical review process changed how I see my own practice. Eight licensed reviewers actually read the work — this is not a content mill.Class of MMXXIVVerified Trustpilot ReviewFunctional Medicine Practitioner“I enrolled skeptical. The diploma I earned has opened doors in three countries. The faculty board lends real credibility.Class of MMXXVVerified Trustpilot ReviewHealth Coach · Schola III Alumna“Programs across both faculties — the bachelor side and the clinical side — taught me that this is a real university, not a course platform.Class of MMXXIVVerified Trustpilot ReviewClinical Nutritionist · NSMHAAdmissions · Class of MMXXVI
[H2] The application is open.
We receive 4,000 applications each year and admit 600. The process includes a personal interview, the review of a short essay, and a trial week. Not a test — a conversation.Begin Your Application Early Decision15 June 2026Fall cohort · Limited seatsRegular Round30 July 2026Fall cohort · Standard roundsSpring Application15 November 2026Spring cohort MMXXVIIUniversity Papers·Volume IX·Letter from the Founder
[H2] Why we built a university, not an online school.
When I began practicing functional medicine twenty years ago, there was no university for me. There were American courses for tho

[H1] The University Catalogue
MMXXVI3,059 Specializations25 Colleges12,400+ Enrolled8,700+ Certificates47 Countries— The Course Catalogue —
[H2] Browse every specialization.
3,055 specializations available · across 25 colleges and 6 conferral tiersTierAFCMini DiplomaPPDAPDMPDFPDWhat do the tiers mean?PPDCurrently browsing: Professional Practitioner Diploma (PPD)— 16 modules · 96 lessons · 8–10 weeks · $397FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Adrenal Cortisol
4.9(736)·2,771 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Adrenal Pregnenolone Steal Coach
4.8(280)·1,145 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Adrenal Thyroid Connection
4.9(677)·2,564 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Advanced Bloodwork
4.7(121)·578 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Advanced Hormone Panel
4.8(285)·1,161 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Ai Health Coaching Practitioner
4.8(488)·1,888 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Allergy Coaching
4.7(213)·906 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Als Wellness
4.8(283)·1,154 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Amputation Adjustment
4.8(380)·1,503 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Andropause Coaching
4.8(571)·2,182 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Autoimmune Anti-Inflammatory Diet
4.8(497)·1,918 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Autoimmune Antibody
4.9(633)·2,406 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Autoimmune Flare
4.8(428)·1,673 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Autoimmune Foot Care Coach
4.9(752)·2,831 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Autoimmune Pregnancy Nutrition
4.7(167)·739 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Autoimmune Pregnancy Support
4.8(607)·2,313 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Autoimmune Thyroid Nutrition Coach
4.9(777)·2,920 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Autoimmune Wellness
4.9(784)·2,944 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Bioelectric Medicine Coaching
4.9(777)·2,918 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Biohacking
4.8(402)·1,579 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Bioidentical Hormones
4.8(494)·1,910 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Biological Age
4.8(550)·2,109 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Biomarker Tracking Specialist
4.8(379)·1,499 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →FIMFIM?-43%FIM · Functional & Integrative Medicine
[H3] Blood Sugar Ketosis Transition
4.9(729)·2,746 enrolled·Accredited ✓CADr. Catherine AldridgeFaculty DirectorPPD$397$69716 modules · 96 lessons8–10 weeks·Intermediate·48 CE creditsEnroll in PPD — $397View Curriculum →Load Next 24 · 3,031 Remaining— Career Pathways —
[H2] Build Your Career
Choose a career path and follow the credential journey from foundation to mastery.?
[H3] Functional Medicine Practitioner
Help patients find root causes of chronic illnessPath:AFC → PPD → FPD|Est. salary:$85,000–$150,000Start This Path →?
[H3] Holistic Wellness Coach
Guide clients through natural healing and lifestyle changePath:AFC → Mini Diploma → PPD|Est. salary:$55,000–$95,000Start This Path →?
[H3] Child Development Specialist
Support families with developmental challenges and coachingPath:AFC → PPD → APD|Est. salary:$60,000–$100,000Start This Path →?
[H3] Clinical Nutrition Expert
Design evidence-based nutrition protocols for patientsPath:AFC → PPD → MPD|Est. salary:$70,000–$120,000Start This Path →?
[H3] Advanced Practice Nurse
Expand clinical capabilities with specialized certificationsPath:AFC → PPD → APD → FPD|Est. salary:$90,000–$160,000Start This Path →?
[H3] Women's Health Specialist
Focus on hormonal health, fertility, and reproductive wellnessPath:AFC → PPD → MPD|Est. salary:$65,000–$110,000Start This Path →— Pathway Advisory · Office Of Admissions —
[H2] Find your pathway.
Two questions, answered honestly. The Registrar will draft a recommended starting sequence drawn from the catalogue.I. Who Are You, Coming In?Healthcare NurseWellness CoachDoctor / MDTherapistCareer ChangerOther Background— Office Of Admissions —
[H2] Begin your conferral.
A scholarship admits you to the entire catalogue — every college, every specialization, every tier — for the lifetime of your practitioner pathway.Apply for Scholarship →Explore All Degrees

Legal Document
[H1] Privacy Policy
Your Privacy Rights and Our Data PracticesAccrediPro University — Private International InstitutionLast Updated: February 14, 2026
[H3] Our Commitment to Your Privacy
AccrediPro University ("APU," "we," "us," or "our") is committed to protecting your privacy and ensuring the security of your personal information. This Privacy Policy explains how we collect, use, disclose, and safeguard your information when you use our website, learning management system, degree programs, and related services.
[H2] 1. Introduction
[H3] 1.1 Data Controller
AccrediPro University acts as the data controller for personal information collected through our platforms. As the data controller, we determine the purposes and means of processing your personal data and are responsible for ensuring compliance with applicable data protection laws.
[H3] 1.2 Scope of This Policy
This Privacy Policy applies to all personal information collected through:Our website at accrediprouniversity.com and all associated domainsOur learning management system (LMS) and student portalsDegree programs, certification programs, mini masters, and educational coursesCommunity forums, group coaching, and mentorship programsEmail communications and marketing materialsCustomer support interactions and feedback submissions
[H3] 1.3 Agreement to This Policy
By accessing our services, creating an account, enrolling in a program, or otherwise providing your information, you acknowledge that you have read, understood, and agree to the practices described in this Privacy Policy.
[H2] 2. Information We Collect
[H3] 2.1 Personal Information You Provide
Identity Information: Full legal name, date of birth, professional credentials, and titleContact Information: Email address, phone number, mailing address, and country of residenceAccount Information: Username, password, security questions, and preferencesPayment Information: Credit/debit card details and billing address (processed via third-party processors)Professional Background: Education history, experience, occupation, and career goalsCommunication Content: Messages, support tickets, feedback, and survey responses
[H3] 2.2 Usage Data and Analytics
Device Information: IP address, browser type, operating system, device identifiersAccess Logs: Login times, session duration, pages visited, features usedReferral Data: How you arrived at our websiteGeographic Data: Approximate location based on IP geolocation
[H3] 2.3 Learning Analytics
Course Progress: Lessons completed, modules accessed, completion percentageVideo Engagement: Watch duration, completion rates, playback patternsAssessment Performance: Quiz scores, exam results, certification test attemptsCommunity Participation: Forum posts, comments, reactions, peer interactions
[H3] 2.4 Cookies and Tracking Technologies
Essential Cookies: Required for basic functionality, authentication, and securityFunctional Cookies: Remember preferences and login statusAnalytics Cookies: Help understand visitor behavior to improve performanceMarketing Cookies: Track advertising effectiveness and enable targeted marketing
[H2] 3. How We Use Your Information
[H3] 3.1 Course Delivery and Educational Services
Provide access to purchased courses and degree programs, track your progress, deliver personalized learning recommendations, facilitate community discussions, and provide coaching and mentorship services.
[H3] 3.2 Degree and Credentialing
Issue degrees, certificates, mini masters, and professional credentials upon program completion. Maintain credential verification systems for employers and organizations. Track continuing education requirements.
[H3] 3.3 Marketing and Communications
Send transactional emails, deliver newsletters and program updates, notify you of new courses, conduct surveys, and personalize marketing messages based on your interests.
[H3] 3.4 Security and Fraud Prevention
Protect against unauthorized access and fraud, verify identity, investigate security incidents, document transactions for dispute resolution, and comply with anti-fraud requirements.
[H2] 4. Legal Bases for Processing
Contractual Necessity: Processing necessary to fulfill our contract with you — access to courses, progress tracking, credential issuance, support.Consent: Where you have given explicit consent, such as opting into marketing communications or surveys. You may withdraw consent at any time.Legitimate Interests: Improving programs, preventing fraud, conducting business analytics, marketing to existing customers, and maintaining legal records.Legal Obligations: Compliance with applicable laws, tax obligations, record-keeping, and responding to legal processes.
[H2] 5. Information Sharing and Disclosure
[H3] 5.1 Service Providers
We share information with third-party service providers including payment processors (Stripe, PayPal), cloud hosting (AWS, Vercel), email delivery providers, analytics platforms, and customer support tools. These providers are contractually bound to protect your information.
[H3] 5.2 Credential Verification
With your consent, we may share limited information with employers or organizations seeking to verify your AccrediPro University credentials (name, credential type, date of issuance, validity status).
[H3] 5.3 Legal Requirements
We may disclose information when required by valid subpoenas, court orders, law enforcement requests, security investigations, or to protect our rights and safety.
[H3] 5.4 Business Transfers
In the event of a merger, acquisition, or sale of assets, your information may be transferred to the acquiring entity. We will notify you via email of any change in ownership.
[H2] 6. International Data Transfers
AccrediPro University is headquartered in the United States with a regional office at Meydan Grandstand, 6th floor, Meydan Road, Nad Al Sheba, Dubai, U.A.E. We serve students in over 45 countries worldwide. Your personal information may be transferred to, stored, and processed in the United States, UAE, or other countries where we maintain facilities.We implement appropriate safeguards including EU-approved Standard Contractual Clauses (SCCs), Data Processing Agreements, and supplementary technical measures. By using our services, you consent to the transfer of your information to countries that may have different data protection laws.
[H2] 7. Data Security
We implement comprehensive security measures including:Encryption: TLS/SSL for data in transit, AES-256 for data at restAccess Controls: Role-based access with logging and monitoringAuthentication: Strong passwords and two-factor authentication (2FA)Infrastructure: SOC 2 Type II certified data centersRegular Audits: Security assessments, vulnerability scans, and penetration testingIn the event of a data breach, we will investigate and contain it promptly, notify affected users and authorities as required by law, and conduct a post-incident review.
[H2] 8. Data Retention
Data TypeRetention PeriodAccount InformationDuration of account + 7 yearsCertification RecordsPermanently (credential verification)Course Progress DataDuration of account + 3 yearsTransaction Records7 years (tax/legal compliance)Support Tickets3 years after resolutionMarketing PreferencesUntil unsubscribe + 2 yearsSecurity Logs1 year
[H2] 9. Your Privacy Rights
[H4] Right to Access
Request a copy of your personal information.
[H4] Right to Correction
Request correction of inaccurate information.
[H4] Right to Deletion
Request deletion (subject to legal retention).
[H4] Right to Portability
Receive data in a structured, machine-readable format.
[H4] Right to Object
Object to processing for legitimate interests or marketing.
[H4] Right to Restrict
Request restriction of processing in certain circumstances.To exercise any of these rights, contact us at registrar@accrediprouniversity.com. We will respond within 30 days.
[H3] 9.1 Opt-Out of Marketing
You can unsubscribe from marketing emails at any time via the "unsubscribe" link. You will continue to receive transactional emails related to your account and courses.
[H2] 10. California Privacy Rights (CCPA/CPRA)
Additional rights for California residents under the California Consumer Privacy Act and California Privacy Rights Act.If you are a California resident, you have additional rights including: Right to Know, Right to Delete, Right to Correct, Right to Opt-Out of Sale/Sharing, Right to Limit Use of Sensitive Information, and Right to Non-Discrimination.California residents may submit requests by emailing registrar@accrediprouniversity.com with "California Privacy Request" in the subject line.
[H2] 11. European Privacy Rights (GDPR)
Additional protections for residents of the European Economic Area, United Kingdom, and Switzerland.If you are located in the EEA, UK, or Switzerland, you have rights under the GDPR including: Right of Access (Art. 15), Rectification (Art. 16), Erasure (Art. 17), Restriction (Art. 18), Data Portability (Art. 20), Right to Object (Art. 21), and Right Related to Automated Decisions (Art. 22).You have the right to lodge a complaint with a supervisory authority. For GDPR-related inquiries, contact registrar@accrediprouniversity.com.
[H2] 12. Cookies and Tracking Technologies
[H4] Strictly Necessary Cookies
Essential for website functionality, authentication, and security. Cannot be disabled.Examples: Session cookies, CSRF tokens
[H4] Functional Cookies
Remember preferences and provide enhanced features.Examples: Language preferences, video player settings
[H4] Analytics Cookies
Help understand visitor behavior to improve performance.Examples: Google Analytics, page view tracking
[H4] Marketing Cookies
Track advertising effectiveness and enable personalized ads.Examples: Facebook Pixel, Google AdsYou can control cookies through your browser settings. Our website does not currently respond to Do Not Track (DNT) signals.
[H2] 13. Children's Privacy
Our services are designed for adult professional education and are not directed to children under 18. We do not knowingly collect personal information from children under 18. If we learn that we have, we will delete that information promptly. Contact us at registrar@accrediprouniversity.com if you believe we have inadvertently collected information from a child.
[H2] 14. Third-Party Links and Services
Our website may contain links to third-party websites not owned or controlled by AccrediPro University. We are not responsible for the privacy practices of these third-party sites. We encourage you to read their privacy policies before providing personal information.
[H2] 15. Changes to This Privacy Policy
We may update this Privacy Policy from time to time. For material changes, we will post the updated policy with a new "Last Updated" date, send an email notification, and display a prominent notice on our platform. Your continued use after the effective date constitutes acceptance of the revised policy.
[H2] 16. Contact Information
AccrediPro UniversityUnited States HeadquartersDubai Office: Meydan Grandstand, 6th floor, Meydan Road, Nad Al Sheba, Dubai, U.A.E.Privacy Inquiries: registrar@accrediprouniversity.comGeneral Support: support@accrediprouniversity.comWe aim to respond to all privacy inquiries within 30 days.© 2026 AccrediPro University. All Rights Reserved.Terms of ServiceRefund PolicyCookie PolicyDisclaimer